PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 365aa    MW: 41861.4 Da    PI: 7.2331
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00265genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-1179111335
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                 ++k +rr+++NReAAr+sR+RKka++++Le+  
  AA44G00265  79 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSR 111
                 6899*************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-776121No hitNo description
SMARTSM003381.1E-677140IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.63479121IPR004827Basic-leucine zipper domain
PfamPF001705.3E-979109IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.39E-781115No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141441.7E-29167242IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MNTTSTHFVP PRRVGIYEPL HQIGMWGESF KANGDMNMHN NTIIIPTNEK LDSLSEDTSH  60
GTEGTTHKFD QEVSTSRHPD KIQRRLAQNR EAARKSRLRK KAYVQQLETS RLKLIHLEQE  120
LDRARQQGFY VGNGVDTNTL GFSDSINPGI AAFEMEYGHW VEEQNRQICE LRTVLHGHVS  180
DIELRLLVDN SMKHYFELFR MKSTAAKLDV FYIMSGMWKT SAERFFLWIG GFRPSELLKV  240
LLPHFDPLTD QQLLDVCNLR QSCQQAEDAL SQGMEKLQQT LAESVAAGQL GEGSYIPQMS  300
TAMERLEALV SFVNQADHLR HETLQQMYRI LTTRQAARGL LALGEYFQRL RALSSSYATR  360
QREPT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190270.10.0transcription factor TGA4
RefseqNP_196565.10.0transcription factor TGA4
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLQ24JJ30.0Q24JJ3_ARATH; At5g10030
STRINGAT5G10030.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4